DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and GTS1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_011334.1 Gene:GTS1 / 852694 SGDID:S000003149 Length:396 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:52/286 - (18%)
Similarity:97/286 - (33%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PQAESSSAEQSSGSQDGDDDNNLLRSLGTTSKLL------GEAIGERITFKAKGAK--KRL---- 271
            |:...|..:...|..|..|:.|..||...:....      .:..|.|.:|::.|::  ::|    
Yeast   139 PEDFGSRMDDFDGESDRFDERNRSRSRSRSHSFYKGGHNRSDYGGSRDSFQSSGSRYSRQLAELK 203

  Fly   272 DRNF---KSSTEAISNIGADAGRSLKHASKRFGSNFSLGRNKDKADIGIGGRPGGSGEMDLDRRQ 333
            |..|   ..:.:|:|:...:..|::.:..|.     |..||...|.......|       |.||:
Yeast   204 DMGFGDTNKNLDALSSAHGNINRAIDYLEKS-----SSSRNSVSAAATTSTPP-------LPRRR 256

  Fly   334 TM---PSTEVFNTIQFSSPLNRNGGLPDLRENDAKLQKEDYLRPDPDQEDDGCYEVPKTQGKPPS 395
            ..   |...:|:        ..|...||...|.|..                      .|.||..
Yeast   257 ATTSGPQPAIFD--------GTNVITPDFTSNSASF----------------------VQAKPAV 291

  Fly   396 YDEALRSRPSPSDSPMSRNLAQEAAQLVQLRNQRQ-----LSSSSSNGDESPRLPMPAFPPPRLS 455
            :|..|:....|:...:..:..|.|..:.|.:.|:|     .:.:.:......::...|....:..
Yeast   292 FDGTLQQYYDPATGMIYVDQQQYAMAMQQQQQQQQQLAVAQAQAQAQAQAQAQVQAQAQAQAQAQ 356

  Fly   456 QQPEQFRMDALQPPVRQKRRKNYEHI 481
            .|.:|.:|..||...:|:...:::.:
Yeast   357 AQAQQIQMQQLQMQQQQQAPLSFQQM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
GTS1NP_011334.1 COG5347 8..310 CDD:227651 40/212 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3385
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.