DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Smap2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_598477.2 Gene:Smap2 / 69780 MGIID:1917030 Length:428 Species:Mus musculus


Alignment Length:398 Identity:69/398 - (17%)
Similarity:111/398 - (27%) Gaps:169/398 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NILLDQRSSICSEVSTTSVQTPGKADEDREGSRYAS--------------------------NAS 179
            |:||::.:..|             ||...:|.|:||                          :.:
Mouse    18 NLLLEEDNKFC-------------ADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVN 69

  Fly   180 LD--------CSESSHSGKFKSQSPGYVDAVDSSIPQSDHPDPNGHHPQAESSSAE--QSSGSQD 234
            ||        |.:...:||.......|:...... ||.|        |..|....:  :.....|
Mouse    70 LDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRR-PQID--------PAVEGFIRDKYEKKKYMD 125

  Fly   235 GDDDNNLLR----------SLGTTSKLLGEAIGERITFKAKGAKKRLDRNF--KSSTEAISNIGA 287
            ...|.|:||          :.....|.:...:.|::....|....:|.|..  ||:...:..:|.
Mouse   126 RSLDINVLRKEKDDKWKRGNEPAPEKKMEPVVFEKVKMPQKKEDAQLPRKSSPKSAAPVMDLLGL 190

  Fly   288 DAGRSLKHASKRFGSNFSLGRNKDKADIGIGGRPGGSGEMDLDRRQTMPSTEVFNTIQFSSPLNR 352
            ||..:...|:.:..:..                     |.|||...::||         .|.::|
Mouse   191 DAPVACSIANSKTSNAL---------------------EKDLDLLASVPS---------PSSVSR 225

  Fly   353 N--GGLPDLRENDAKLQKEDYLRPDPDQEDDGCYEVPKTQGKPPSYDEALRSRPSPSDSPMSRNL 415
            .  |.:|                               |.|...|..|.|...|.|...      
Mouse   226 KAVGSMP-------------------------------TAGSAGSVPENLNLFPEPGSK------ 253

  Fly   416 AQEAAQLVQLRNQRQLSSS---SSNGDESPRLP----------------MPAFPPPRLSQQPEQF 461
            ::|.       .::|||..   |..|.::|::|                .|:||    ...|...
Mouse   254 SEET-------GKKQLSKDSILSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSFP----GVTPPNS 307

  Fly   462 RMDALQPP 469
            .|..:.||
Mouse   308 IMGGMVPP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Smap2NP_598477.2 ArfGap 13..126 CDD:307528 21/129 (16%)
Interaction with clathrin heavy chains 163..231 18/97 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..262 14/96 (15%)
Med15 276..>416 CDD:312941 9/44 (20%)
Interaction with PICALM. /evidence=ECO:0000269|PubMed:16571680 339..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.