DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Smap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_003750716.3 Gene:Smap1 / 684800 RGDID:1585595 Length:467 Species:Rattus norvegicus


Alignment Length:308 Identity:65/308 - (21%)
Similarity:114/308 - (37%) Gaps:70/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 RNLAQEAAQLVQLR----NQRQLSSSSSNGDESPRLPMPA-----FPPPRLSQQPEQFRMDALQP 468
            |||....:::..:.    ...|:......|:...||...|     |..|:..|..|.|..|    
  Rat    61 RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRD---- 121

  Fly   469 PVRQKRRKNYEHIELR-----------RPPVDSAQLEELNRAAAAAEREESLLISAKNAEAETKT 522
              :.:::|.|:...:.           :|.|.|..|      .||.::.:......|..|.:.:.
  Rat   122 --KYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSL------PAAVDKNKIEKEKEKKKEEKKRE 178

  Fly   523 PKPERSDSWEFYGEDENEEEDRDEEQEGSSSPEPLYANQEATYGKLFEMATAGSSRSNVLTPNQV 587
            .:||: .:.....|...::||:..|.:.|:||:.:   .|.|...|   ...|.:.:.|...|..
  Rat   179 KEPEK-PAKALTTEKLQKKEDQQPEPKKSTSPKNV---AEPTVDLL---GLDGPAEAPVTNGNTT 236

  Fly   588 AEQQQLACITEDSELDACEGAVGGVPLPQAVIEEFD-----PLSSKCSTLA---------RSNKS 638
            |...    :::|.::   .|.:...|||.||:.:..     |.::..||:.         ::.||
  Rat   237 AAPP----LSDDLDI---FGPMISNPLPAAVMPQAQGTASIPAAAALSTITSGDLDLFTEQTTKS 294

  Fly   639 NELLLLEHLLEEDT----YGTVKAEQDDVSMCTSEEEPTTSAATSPKP 682
            .|  ..:..|.:|:    ||| .|:|....:...   ||....||..|
  Rat   295 EE--GAKKQLSKDSILSLYGT-GAQQSTPGVFMG---PTNIPFTSQAP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Smap1XP_003750716.3 ArfGap 20..120 CDD:279720 13/58 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.