DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and SMAP2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_073570.1 Gene:SMAP2 / 64744 HGNCID:25082 Length:429 Species:Homo sapiens


Alignment Length:398 Identity:71/398 - (17%)
Similarity:110/398 - (27%) Gaps:168/398 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NILLDQRSSICSEVSTTSVQTPGKADEDREGSRYAS--------------------------NAS 179
            |:||::.:..|             ||...:|.|:||                          :.:
Human    18 NLLLEEDNKFC-------------ADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVN 69

  Fly   180 LD--------CSESSHSGKFKSQSPGYVDAVDSSIPQSDHPDPNGHHPQAESSSAE--QSSGSQD 234
            ||        |.:...:||.......|:...... ||.|        |..|....:  :.....|
Human    70 LDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRR-PQID--------PAVEGFIRDKYEKKKYMD 125

  Fly   235 GDDDNNLLR----------SLGTTSKLLGEAIGERITFKAKGAKKRLDRNF--KSSTEAISNIGA 287
            ...|.|..|          |.....|.|...:.|::....|....:|.|..  ||:...:..:|.
Human   126 RSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGL 190

  Fly   288 DAGRSLKHASKRFGSNFSLGRNKDKADIGIGGRPGGSGEMDLDRRQTMPSTEVFNTIQFSSPLNR 352
            ||..:...|:.:..:..                     |.|||...::||.        ||..:|
Human   191 DAPVACSIANSKTSNTL---------------------EKDLDLLASVPSP--------SSSGSR 226

  Fly   353 N--GGLPDLRENDAKLQKEDYLRPDPDQEDDGCYEVPKTQGKPPSYDEALRSRPSPSDSPMSRNL 415
            .  |.:|                               |.|...|..|.|...|.|...      
Human   227 KVVGSMP-------------------------------TAGSAGSVPENLNLFPEPGSK------ 254

  Fly   416 AQEAAQLVQLRNQRQLSSS---SSNGDESPRLP----------------MPAFPPPRLSQQPEQF 461
            ::|.       .::|||..   |..|.::|::|                .|:||    ...|...
Human   255 SEEI-------GKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFP----GVTPPNS 308

  Fly   462 RMDALQPP 469
            .|.::.||
Human   309 IMGSMMPP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
SMAP2NP_073570.1 ArfGap_SMAP2 16..122 CDD:350083 21/125 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..184 9/45 (20%)
Interaction with clathrin heavy chains. /evidence=ECO:0000250 163..232 19/97 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..259 15/93 (16%)
Interaction with PICALM. /evidence=ECO:0000250 340..429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.