Sequence 1: | NP_573183.2 | Gene: | RhoGAP15B / 32686 | FlyBaseID: | FBgn0030808 | Length: | 1552 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024306599.1 | Gene: | ADAP2 / 55803 | HGNCID: | 16487 | Length: | 403 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 51/245 - (20%) |
---|---|---|---|
Similarity: | 82/245 - (33%) | Gaps: | 83/245 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 868 RKAIL--RERQFQTFLDQEMKTPREMIPL-DTITTLQCVSNSRVTDTATHFYCFEITTSQPKNGN 929
Fly 930 GAGDAMSSNPNLLMTSSSSGNVKQQRVSHLYGVGKE---------SERGVWMQKILESLTNSLPV 985
Fly 986 KY-TCHYYRAGWCYLKNSITSE-WSGTWLVLRKSQRRLIFVSEA----------NGNVEK----- 1033
Fly 1034 MDLRKA----------------RCIVL-----KESDESIDNLH-VESGPM 1061 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP15B | NP_573183.2 | RhoGAP_ARAP | 1095..1277 | CDD:239850 | |
ADAP2 | XP_024306599.1 | ArfGap | 8..126 | CDD:307528 | |
PH1_ADAP | 133..241 | CDD:270072 | 23/120 (19%) | ||
PH2_ADAP | 255..362 | CDD:241282 | 22/106 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |