DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and CenB1A

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster


Alignment Length:443 Identity:81/443 - (18%)
Similarity:149/443 - (33%) Gaps:164/443 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1014 LRKSQRRLIFVSEANGNVEKMDLRKARCIVLKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSA 1078
            |:.|.|...|||:...::|.::.|..:.|       .:.|:.|:||          ..|:...||
  Fly    11 LKDSPRFRQFVSKEESDIEHLEQRLEKII-------KLCNVAVDSG----------KEYVKNQSA 58

  Fly  1079 RETKIW---RHII-REVAHNNGFSLGD-----QQLTRYDVPVIVDKCIN------FVYIHGSMSE 1128
            ....:|   :|.: .:.|||   :||.     |::.::.. :::|:...      .|::...:::
  Fly    59 FAMSLWDLQQHFLDNKNAHN---ALGKLIHCFQEMNKFHT-ILLDQASRTVLKNLSVFVKDDINQ 119

  Fly  1129 -----GIYRK--SGSENSMHKLMSAFRADAFNVEITRNEYNE-HDVANVLKRFMRDLPERLLGKL 1185
                 |.:.|  .|.:|::.|          |.:.::|...| .:.||:|.              
  Fly   120 VKDYKGHFLKVSEGYDNALIK----------NAQASKNRPQEMQEAANILS-------------- 160

  Fly  1186 TDSFVFVTELAVASEKIPIYRELLARLSAIERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGP 1250
                                    |..|..:...|    .::.:|:..||:...|:.:       
  Fly   161 ------------------------ASKSCFQHTAL----DYVNYITLAQARKVPSILS------- 190

  Fly  1251 TLLAKKSDELIYSQKEADVLSDLVVLYKN----LFPCSADEIKREQAMLACLQKYYAAAETLKDA 1311
            |||......:.|..:..|:.:|....:||    |.....|..:.|:||    |..:.:.....|:
  Fly   191 TLLDYYQACVTYYHQGFDLCNDFDEFFKNISEDLNALRGDYQQLEKAM----QNRHMSVNRYCDS 251

  Fly  1312 VKQSGDIKI------------------WISLNPN--------------------------PENKT 1332
            ...|...||                  |..|:.|                          |.|:.
  Fly   252 NTNSTSNKIEGYLFKKKSKGFKTWCRRWFYLSDNQLVYRKRSNEDSFSVMEEDLRICSVRPVNEG 316

  Fly  1333 EEKTQVNATISPTKTAYELCREYSAKMQLPTHQLTLYEVILNDSLERPLHHDT 1385
            :.:.... .|||||:  .:.:..||.|      |:|:...|..|:...:.||:
  Fly   317 DRRFCFE-VISPTKS--HILQADSADM------LSLWISALQHSIGAAIQHDS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 29/200 (15%)
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287 47/278 (17%)
PH 259..352 CDD:278594 18/101 (18%)
PH_ACAP 260..355 CDD:270070 18/103 (17%)
ArfGap 384..497 CDD:279720
ANK 652..768 CDD:238125
Ank_4 683..736 CDD:290365
ANK repeat 687..713 CDD:293786
ANK repeat 715..746 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.