DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and ArfGAP1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_524040.2 Gene:ArfGAP1 / 39417 FlyBaseID:FBgn0020655 Length:468 Species:Drosophila melanogaster


Alignment Length:301 Identity:62/301 - (20%)
Similarity:92/301 - (30%) Gaps:123/301 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DSQQPIYGPDANENVQEPVYATPRPAPRQRLPP------AG-----EPEDSYPDPDDEVPLRILR 130
            |.::..:.....||...|          :.|||      ||     ||                 
  Fly   185 DQKEEFFSRRQVENASRP----------ENLPPSQGGKYAGFGFTREP----------------- 222

  Fly   131 AAPQIPPKPLN-ILLDQRSSICSEVSTTSVQTPGKADEDREGSRYASNA---------------- 178
                 |||..: .|.|         ||.|....|.:......|:.||.|                
  Fly   223 -----PPKTQSQELFD---------STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIK 273

  Fly   179 ------SLDCSESSHSGKFKSQSP-GYVDAVDSSI--PQSDHPDPNGHHPQAESSSAEQSSGSQD 234
                  |:.|..:..:.|...... |:.:...|:|  ||..:.|||     .|.|||.|.|.|..
  Fly   274 EGTLLDSVQCGVTDVASKVTDMGKRGWNNLAGSNISSPQGGYNDPN-----FEDSSAYQRSNSVG 333

  Fly   235 GD-------------------DDNNLLRSLGTTSKLLGEAIGERITFKAKG--AKKRLDR----- 273
            |:                   .||...:|..|:|    .:...:::..:.|  |...|.|     
  Fly   334 GNLAGGLGQQSGVSDSDWGGWQDNGNSKSHMTSS----SSYHNQLSSSSGGGTASAGLTRDADWS 394

  Fly   274 -----NFKSSTEAISNI---GADAGRSLK--HASKRFGSNF 304
                 |::||..:..|.   |:.|.|::|  ..|::....|
  Fly   395 GFEATNYQSSETSYQNASSGGSTARRNMKLQDTSQKLSEGF 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
ArfGAP1NP_524040.2 ArfGap 7..114 CDD:279720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.