DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and AGFG2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_005250363.1 Gene:AGFG2 / 3268 HGNCID:5177 Length:492 Species:Homo sapiens


Alignment Length:241 Identity:50/241 - (20%)
Similarity:69/241 - (28%) Gaps:100/241 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LPSSGQNKLILQENNSDSQQPIYGPDANENVQEPVYATPRPAPRQRLPPAGEPEDSYPD------ 119
            ||.:||.....|...:.|:..........:...|..|||       |.||.:| :|..|      
Human   277 LPPAGQASFQAQPTPAASRMLTESYSFGSSQGTPFGATP-------LAPASQP-NSLADVGSFLG 333

  Fly   120 ---PDDEVPLRILRAAPQIPPKPLNILLDQRSSICSEVSTTSVQTPGKADEDREGSRYASNASLD 181
               |...||..:...|.|:||                  ..|| |.|.......|..:       
Human   334 PGVPAAGVPSSLFGMAGQVPP------------------LQSV-TMGGGGGSSTGLAF------- 372

  Fly   182 CSESSHSGKFKSQSPGYVDAVDSSIPQSDHPDPNG--------------HHPQA----------- 221
                   |.|  .:|....|..|.:|.::...|||              ..|||           
Human   373 -------GAF--TNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSF 428

  Fly   222 -------ESSSAEQSSGSQDGDDDNNLLRSLGTTSKLLGEA-IGER 259
                   ::...:|.:||..||               ||.| :|:|
Human   429 PAPLFPPQTPLVQQQNGSSFGD---------------LGSAKLGQR 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
AGFG2XP_005250363.1 ArfGap 40..147 CDD:295313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.