DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and acap3a

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_021325699.1 Gene:acap3a / 322991 ZFINID:ZDB-GENE-030131-1711 Length:845 Species:Danio rerio


Alignment Length:407 Identity:72/407 - (17%)
Similarity:148/407 - (36%) Gaps:99/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1203 PIYRELLARLSAIERET---------LRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAK--K 1256
            |.:|   |.:..:|.|.         |.::.|.::     :|.......|...|.|...|::  |
Zfish    13 PRFR---ANIDEVETEVVEIEAKLDKLVKLCGGMI-----EAGKAYVTANKLFINGIRDLSQHCK 69

  Fly  1257 SDELIYS--QKEADVLSDLVVLYKNLFPCSADEIKRE--QAMLACLQKYYAAAETLKDAVKQSGD 1317
            .|::|..  :|..:.|.::|..:..||..:...:|::  ..:...::|:   .:|.|...|...|
Zfish    70 KDQMISDCLEKCGEGLQEIVNYHMILFDQAQRSVKQQLHNFVKEDVRKF---KDTKKQFDKVRED 131

  Fly  1318 IKIWISLNPN-PENKTEEKTQVNATISPTKTAY-ELCREY----------------SAKMQLPTH 1364
            ::|....|.. |.||..|..:..:|::.|:..: .|..:|                .|.:.....
Zfish   132 LEIAQVKNAQAPRNKPHEVEEATSTLNFTRKCFRHLALDYVLQINVLQAKKKFEILDAMLSFMHA 196

  Fly  1365 QLTLYEVILN--DSLERPLHHDTKVFDVILNWSYWPEEDRKHNYLVVRPVEMLREIQRAVKNL-- 1425
            |.:||:...|  |.::..:.......|.::..|...:.:.:|.:..::...:|::.......|  
Zfish   197 QYSLYQQGYNLLDEIDPYMKKLAAELDQLVIDSAMEKREMEHKHATIQQRTLLQDFAYDDPKLEY 261

  Fly  1426 ------ATVTPGKELRFADSRTKTFKTLQCELRDGKIVVSKKDKNDKTTIVREIFLQSSTAYLGC 1484
                  ..|..|...:.|.:..||:......:::.::|..||.|:..|.:|.::.|.|.......
Zfish   262 NVDAPNGLVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDSLTVVVEDLRLCSVKPCEDI 326

  Fly  1485 ERK-------------------------------------RDFPWSWAITFVERTQAQIMRSRDA 1512
            ||:                                     |:.|.::.|..::||.        :
Zfish   327 ERRFCFEVVSPTKSCMLQAESEKLRQAWIQAVQASIASAYRESPDNYYIERLDRTA--------S 383

  Fly  1513 PFIGHVLAGSEWGDRTI 1529
            |.|..:.:.||..:|::
Zfish   384 PSISSIDSASESRERSV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 18/86 (21%)
acap3aXP_021325699.1 BAR 16..215 CDD:325158 41/209 (20%)
PH_ACAP 271..367 CDD:270070 14/95 (15%)
ArfGap 403..520 CDD:307528
ANK 674..790 CDD:238125
ANK repeat 674..700 CDD:293786
ANK repeat 702..735 CDD:293786
ANK repeat 737..762 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.