DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Acap3

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001382677.1 Gene:Acap3 / 313772 RGDID:1310711 Length:833 Species:Rattus norvegicus


Alignment Length:350 Identity:68/350 - (19%)
Similarity:128/350 - (36%) Gaps:97/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 NVEKMDLRKARCIVLKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSARETKIWRHIIREVAHN 1094
            |..|.|:||     .||:.:..|.:..:               |.:|..|..:..||...||.. 
  Rat   109 NFVKEDVRK-----FKETKKQFDKVRED---------------MELSLVRNAQAPRHRPHEVEE- 152

  Fly  1095 NGFSLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAFRADAFNVEITRN 1159
               :.|...|||        ||...:.:...:...:.:.......:..::|...|          
  Rat   153 ---ATGALTLTR--------KCFRHLALDYVLQINVLQAKKKFEILDSMLSFMHA---------- 196

  Fly  1160 EYN----EHDVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYRELLARLSAIERETL 1220
            :|:    .:.:.:.|..:|:.|...|...:.||         |.||    ||:..:.:||::.||
  Rat   197 QYSFFQQGYSLLHQLDPYMKKLAAELDQLVIDS---------AVEK----REMERKHAAIQQRTL 248

  Fly  1221 RRIVGHLVFISSQQAKNKMSV----------------QNLTMIWGPTLLAKKSDELIYSQKEADV 1269
                  |...|..:.|.:..|                .|....|.....:.::.:|:|.:|..|.
  Rat   249 ------LQDFSYDEPKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDA 307

  Fly  1270 LSDLVVLYKNLFPCS---ADEIKRE------QAMLACLQKYYAAAETLKDAVKQSGDIKIWISLN 1325
            |:   |:..:|..||   .::|:|.      ....:|:.:  |.:|.|:.|..|:....|..:..
  Rat   308 LT---VVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQ--ADSEKLRQAWVQAVQASIASAYR 367

  Fly  1326 PNPENKTEEKTQVNATISPTKTAYE 1350
            .:|::...|:  ::.|.||:.::.:
  Rat   368 ESPDSCYSER--LDRTASPSTSSID 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 36/201 (18%)
Acap3NP_001382677.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.