DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Agfg2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_006249202.1 Gene:Agfg2 / 304375 RGDID:1306590 Length:488 Species:Rattus norvegicus


Alignment Length:303 Identity:54/303 - (17%)
Similarity:88/303 - (29%) Gaps:133/303 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GYVDAVDSSIPQSDHPD------------PNGHHPQAESSSAEQSSGSQD--------------- 234
            |..||..|.:|.|..|.            ...:.|..:...|..|.||..               
  Rat   113 GLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPEQVKGASYSKGSVSATPVQGSVPEGKPIR 177

  Fly   235 ---GDDDNNLLRSLGTTSKLLGEAIGERITFKAKGAKKRLDR------NFKSSTEAISNIGAD-- 288
               ||...:|..:..|:|:.:.::       :|:.|:.|..:      ..|:||:.:::||.|  
  Rat   178 TLLGDPVPSLSDAASTSSQSVSQS-------QARTAQARSSQPPSHSSTKKASTDLLADIGGDPF 235

  Fly   289 AGRSLKHASKRFGSNFSLGRNKDKADIGIGGR-PGGSGEMDLDRRQTMPSTEVFNTIQFSSPLNR 352
            |...:..|...|.              |.||: |...|..:.|...:.||:..|.::        
  Rat   236 AAPQVAPAFASFP--------------GFGGQNPSHGGFANFDAFSSSPSSSAFGSL-------- 278

  Fly   353 NGGLPDLRENDAKLQKEDYLRPDPDQEDDGCYEVPKTQGKPPSYDEALRSRPSPSDSPMSRNLAQ 417
                                                    |||.....:::|:|:.:        
  Rat   279 ----------------------------------------PPSVQTPFQAQPTPAAN-------- 295

  Fly   418 EAAQLVQLRNQRQLSSSSSNGDESPRLPMPAF--PPPRLSQQP 458
                       |.|:.|.|.|...    |.||  .|...:.||
  Rat   296 -----------RMLTGSYSFGSSQ----MSAFGVAPLAAASQP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Agfg2XP_006249202.1 ArfGap 40..152 CDD:295313 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.