DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Acap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001099266.2 Gene:Acap1 / 287443 RGDID:1305360 Length:740 Species:Rattus norvegicus


Alignment Length:213 Identity:36/213 - (16%)
Similarity:86/213 - (40%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1301 YYAAAETLKDAVKQSGDIKIWISLNPNPENKTEEKTQVNATISPTKTAY-ELCREYSAK------ 1358
            ::..||:|:.|:..:.::         |..:.:|.......:...:..| ....:|:.:      
  Rat   127 FWRGAESLEAALSHNAEV---------PRRRVQEAEDAGTALRTARAVYRSRALDYALQVNVIED 182

  Fly  1359 ----------MQLPTHQLTLYE---VILNDSLERPLHHDTKVFDVILNWSYWPEEDRKHNYLVVR 1410
                      ::|...|.|.::   ..||...:.......::.:::|| |.....|.:..:::::
  Rat   183 KRKFDIMEFILRLVEAQATYFQQGHEELNQLAQYRKELGAQLHNLVLN-SARERRDMEQRHVLLK 246

  Fly  1411 PVEM-LREIQRAVK--NLATVTPGKELRFADSRTKTFKTLQCELRDGKIVVSKKDKNDKTTIVRE 1472
            ..|: ..|.:.::|  :...|..|...:.|.:..||:......:::.::|..||.|:..|.:|.:
  Rat   247 QKELGGEEPEPSLKEGSSGLVMEGHLFKRASNAFKTWSRRWFTIQNNQLVYQKKYKDPVTVVVDD 311

  Fly  1473 IFLQSSTAYLGCERKRDF 1490
              |:..|..|..:.:|.|
  Rat   312 --LRLCTVKLCPDSERRF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Acap1NP_001099266.2 BAR_ACAP1 18..217 CDD:153323 13/98 (13%)
PH 266..360 CDD:278594 16/64 (25%)
PH_ACAP 268..364 CDD:270070 15/62 (24%)
ArfGap 406..519 CDD:279720
ANK repeat 575..602 CDD:293786
ANK <592..692 CDD:238125
Ank_5 592..647 CDD:290568
ANK repeat 606..637 CDD:293786
Ank_5 626..680 CDD:290568
ANK repeat 639..670 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.