DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and ARFGAP3

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_055385.3 Gene:ARFGAP3 / 26286 HGNCID:661 Length:516 Species:Homo sapiens


Alignment Length:466 Identity:84/466 - (18%)
Similarity:154/466 - (33%) Gaps:158/466 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 SAQL--EELNRAAAAAEREESLLISAKNAEAETKTPKPERSDSWEFYGEDENEE----------- 541
            :|||  |::...|:.|.|:....:...:......:|.|:..|   |:....:.|           
Human   109 AAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEED---FFASHVSPEVSDTAWASAIA 170

  Fly   542 --------------EDRDEEQEGSSSPEPLYANQEATYGKLFEMATAGSSRSNVLTPNQVAEQQQ 592
                          |:.:..||...|.|.|....:||    .|:::....:     |||..:   
Human   171 EPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKAT----LEVSSIIKKK-----PNQAKK--- 223

  Fly   593 LACITEDSELDACEGAVGGVPLPQAVIEEFDPLSSKCSTLARSNKSNELLLLEHLLEEDTYGTVK 657
                    .|.|.:|::|...|......|.:..:.....:                         
Human   224 --------GLGAKKGSLGAQKLANTCFNEIEKQAQAADKM------------------------- 255

  Fly   658 AEQDDVSMCTSEEEPTTSAATSPKPQQPQIVHQNARLLSDSMENM-------LDSDQ-------- 707
            .||:|::...|:||...|:.        ::.:::..:.....|.|       :|||:        
Human   256 KEQEDLAKVVSKEESIVSSL--------RLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNC 312

  Fly   708 ---------------ERAKPYLSRMPESANKASG-------------PVDLASASRNRTNWFVPD 744
                           |:..|.:::..:..|..|.             ||:|.|:|  .::|   |
Human   313 RSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEPVELRSSS--FSSW---D 372

  Fly   745 KASCSDVTPNTSKTTPPI-----EGDSP-----PTYLEAIGGSKDAAGNQENRSTIGS--RFRQT 797
            .:|.|.....|||.|..:     ..|.|     |.| |.:..:.:|.....|...|.|  .|.:.
Human   373 DSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDY-EPVENTDEAQKKFGNVKAISSDMYFGRQ 436

  Fly   798 INAISNVKLKMDAMKRKASFRGAN-----QRQSDVRVALQMVPRPSLSPLLIRYE-------GPL 850
            ..|....:.:::.:...:|...|:     ::|.....:|..| .|: :|.:.:::       |.|
Human   437 SQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSV-LPN-APDMAQFKQGVRSVAGKL 499

  Fly   851 VRFPSGVVEDI 861
            ..|.:|||..|
Human   500 SVFANGVVTSI 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
ARFGAP3NP_055385.3 PLN03114 1..464 CDD:178661 72/416 (17%)
ArfGap 12..116 CDD:279720 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 4/28 (14%)
TMF_DNA_bd 246..301 CDD:289127 9/87 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 322..346 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..414 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.