DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Adap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_766311.2 Gene:Adap1 / 231821 MGIID:2442201 Length:374 Species:Mus musculus


Alignment Length:145 Identity:35/145 - (24%)
Similarity:60/145 - (41%) Gaps:42/145 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 SDSPMSRNLAQEAAQLVQLR----NQRQLSSSSSNGDESPRLPMPAFPPPRLSQQP--------- 458
            |.|.:.||:.| .:::..:|    ::.|:...:|:|:|:.|....:..|| ...:|         
Mouse    43 SCSGIHRNIPQ-VSKVKSVRLDAWDEAQVEFMASHGNEAARATFESKVPP-FYYRPTFSDCQLLR 105

  Fly   459 EQFRMDALQPPVRQK-RRKNYEHIELRRP-------------PVDSAQLEELNRAAAAAEREESL 509
            ||:        :|.| .|:.:.|:|.:.|             ..|:.|.  |:|.....|||.:|
Mouse   106 EQW--------IRAKYERQEFVHVEKQEPYSTGYREGLLWKRGRDNGQF--LSRKFVLTEREGAL 160

  Fly   510 LISAKNAEAETKTPK 524
            ....||   :.|.||
Mouse   161 KYFNKN---DAKEPK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Adap1NP_766311.2 ArfGap 10..126 CDD:214518 21/92 (23%)
PH1_ADAP 130..238 CDD:270072 13/48 (27%)
PH2_ADAP 252..357 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.