DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Arfgap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001361599.1 Gene:Arfgap1 / 228998 MGIID:2183559 Length:424 Species:Mus musculus


Alignment Length:327 Identity:67/327 - (20%)
Similarity:115/327 - (35%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 QDDVSMCTSEEEPTTSAATSPKPQQPQIVHQNARLLSDSMENMLDSD--QERAKPYLSRMPESAN 722
            |||.       ||:.|.......:...:.......|::..|..|:|.  |....|....:..:|:
Mouse    90 QDDY-------EPSWSLQDKYSSRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPKTLQFTAH 147

  Fly   723 KASGPVDLASASRNRT--NWFVPDKASCSDVTPNT----SKTTPP--IEGDSPPTYLEAI----- 774
            :|||....|:||.::.  :|...|..|......|.    ..|.||  .|.|.....:.::     
Mouse   148 RASGQPQSAAASGDKAFEDWLNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNAMSSLYSGWS 212

  Fly   775 ----GGSKDAAGNQENRSTIGSRFRQTINAISNVKLKMDAMKRK---ASFRGANQRQSDVRVALQ 832
                |.||.|:..:|..:..||:..|          |....|::   ||..|.:..::.::.|.:
Mouse   213 SFTTGASKFASAAKEGATKFGSQASQ----------KFWGYKQQSEPASELGHSLNENVLKPAQE 267

  Fly   833 MVPR--------PSLSPLLIRYEG-------PLVRFPSGVVEDIL------KEMQN------RKA 870
            .|..        ..:|.|..:.:|       .:..|.||..||..      ...||      :.:
Mouse   268 KVKEGRIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNS 332

  Fly   871 ILRERQFQTFLDQEMKTPREMIP-LDTITTLQCVSNSRVTDTATHFYCFEI----TTSQPKNGNG 930
            .:.:..::||...|  .|:...| .|:.|.....:..|.:|:      :::    :.|..||.|.
Mouse   333 NIDQSFWETFGSAE--PPKAKSPSSDSWTCADASTGRRSSDS------WDVWGSGSASNNKNSNS 389

  Fly   931 AG 932
            .|
Mouse   390 DG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Arfgap1NP_001361599.1 ArfGap_ArfGap1 6..121 CDD:350059 7/37 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.