DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Acap1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_722483.2 Gene:Acap1 / 216859 MGIID:2388270 Length:740 Species:Mus musculus


Alignment Length:213 Identity:36/213 - (16%)
Similarity:89/213 - (41%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1301 YYAAAETLKDAVKQSGDIKIWISLNPNPENKTEEKTQVNATISPTKTAY-ELCREYSAKMQL--P 1362
            ::..||.|:.|:..:.::         |..:.:|..:....:...:..| ....:|:.::.:  .
Mouse   127 FWRGAENLEAALTHNAEV---------PRRRVQEAEEAGTALRTARAGYRSRALDYALQVNVIED 182

  Fly  1363 THQLTLYEVIL-------------NDSLERPLHH----DTKVFDVILNWSYWPEEDRKHNYLVVR 1410
            ..:..:.|.:|             ::.|.|...:    .|::.:::|| |...:.|.:..:::::
Mouse   183 KRKFDIMEFVLRLVEAQATYFQQGHEELNRLAQYRKELGTQLHNLVLN-SARQKRDMEQRHVLLK 246

  Fly  1411 PVEM-LREIQRAVKN--LATVTPGKELRFADSRTKTFKTLQCELRDGKIVVSKKDKNDKTTIVRE 1472
            ..|: ..|.:.::|.  ...|..|...:.|.:..||:......:::.::|..||.|:..|.:|.:
Mouse   247 QKELGGEEPEPSLKEGPSGLVMEGHLFKRASNAFKTWSRRWFTIQNNQLVYQKKYKDPVTVVVDD 311

  Fly  1473 IFLQSSTAYLGCERKRDF 1490
              |:..|..|..:.:|.|
Mouse   312 --LRLCTVKLCPDSERRF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
Acap1NP_722483.2 Required for formation of endosomal tubules when overexpressed with PIP5K1C. /evidence=ECO:0000250|UniProtKB:Q15027 1..382 36/213 (17%)
BAR_ACAP1 18..217 CDD:153323 12/98 (12%)
PH 266..360 CDD:278594 16/64 (25%)
PH_ACAP 268..364 CDD:270070 15/62 (24%)
Required for interaction with GULP1. /evidence=ECO:0000250|UniProtKB:Q15027 405..740
ArfGap 406..519 CDD:279720
Prevents interaction with ITGB1 when S-554 is not phosphorylated. /evidence=ECO:0000250 525..566
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 525..562
Ank_2 575..670 CDD:289560
ANK repeat 575..602 CDD:293786
ANK <592..692 CDD:238125
ANK repeat 606..637 CDD:293786
ANK repeat 639..670 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.