DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and Acap3

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_997106.1 Gene:Acap3 / 140500 MGIID:2153589 Length:833 Species:Mus musculus


Alignment Length:350 Identity:67/350 - (19%)
Similarity:127/350 - (36%) Gaps:97/350 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 NVEKMDLRKARCIVLKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSARETKIWRHIIREVAHN 1094
            |..|.|:||     .||:.:..|.:..:               |.:|..|..:..||...||...
Mouse   109 NFVKEDVRK-----FKETKKQFDKVRED---------------MELSLVRNAQAPRHRPHEVEEA 153

  Fly  1095 NGFSLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKLMSAFRADAFNVEITRN 1159
            .|      .||      :..||...:.:...:...:.:.......:..::|...|          
Mouse   154 TG------ALT------VTRKCFRHLALDYVLQINVLQAKKKFEILDSMLSFMHA---------- 196

  Fly  1160 EYN----EHDVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYRELLARLSAIERETL 1220
            :|:    .:.:.:.|..:|:.|...|...:.||         |.||    ||:..:.:||::.||
Mouse   197 QYSFFQQGYSLLHQLDPYMKKLAAELDQLVIDS---------AVEK----REMERKHAAIQQRTL 248

  Fly  1221 RRIVGHLVFISSQQAKNKMSV----------------QNLTMIWGPTLLAKKSDELIYSQKEADV 1269
                  |...|..:.|.:..|                .|....|.....:.::.:|:|.:|..|.
Mouse   249 ------LQDFSYDEPKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDA 307

  Fly  1270 LSDLVVLYKNLFPCS---ADEIKRE------QAMLACLQKYYAAAETLKDAVKQSGDIKIWISLN 1325
            |:   |:..:|..||   .::|:|.      ....:|:.:  |.:|.|:.|..|:....|..:..
Mouse   308 LT---VVVDDLRLCSVKPCEDIERRFCFEVVSPTKSCMLQ--ADSEKLRQAWVQAVQASIASAYR 367

  Fly  1326 PNPENKTEEKTQVNATISPTKTAYE 1350
            .:|::...|:  ::.|.||:.::.:
Mouse   368 ESPDSCYSER--LDRTASPSTSSID 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 35/201 (17%)
Acap3NP_997106.1 BAR_ACAP3 16..215 CDD:153321 24/147 (16%)
PH 269..363 CDD:278594 19/98 (19%)
PH_ACAP 271..367 CDD:270070 20/100 (20%)
ArfGap 403..521 CDD:279720
ANK 671..786 CDD:238125
Ank_2 671..764 CDD:289560
ANK repeat 700..731 CDD:293786
ANK repeat 733..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.