DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and AgaP_AGAP008912

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_319660.4 Gene:AgaP_AGAP008912 / 1279880 VectorBaseID:AGAP008912 Length:629 Species:Anopheles gambiae


Alignment Length:312 Identity:67/312 - (21%)
Similarity:113/312 - (36%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1018 QRRLIFVSEANGNVEKMDLRKARCIVL-------KESDESIDNLHVESGPMLMIDCPPYAVYMIM 1075
            |:|:.|     ||   ..||...|..:       |.|...:.....::||...|.|  ...|...
Mosquito   322 QQRIRF-----GN---SSLRCRECKAMFHAYCREKISFPCVPQSQTKNGPAGAISC--LDDYCPS 376

  Fly  1076 SSARETKIWRHIIREVAHNNGFSLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSM 1140
            ||.|                             :|.::..|::.:...|....|:||.||||..:
Mosquito   377 SSPR-----------------------------IPALIVHCVSEIENRGLTEVGLYRLSGSEREV 412

  Fly  1141 HKLMSAFRADAFNVEITRNEYNEHDVANVLKRFMRDL-----PERLLGKLTDSFVFVTELAVASE 1200
            ..|...|...  ....|..:.:.:.:.:.:|.|:|.|     |..|||:.:.:....|.......
Mosquito   413 RALKEKFLHG--KTIPTLGQIDVNVLCSCIKDFLRTLREPLIPNALLGEFSSAVSGATSPNGGQR 475

  Fly  1201 KIPIYRELLARLSAIERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKKSDELIYSQK 1265
            ......:|:.||.|..|:||..::.|...::..:|. ||.:.||..::.||::.....:|..::.
Mosquito   476 MRQQLCQLIERLPAPNRDTLAFLMLHFQRVAQSEAA-KMPIDNLARVFAPTIVGYTRADLDMNEM 539

  Fly  1266 EADVLSDLVVLYKNLFPCSADEIKREQAMLACLQKYYAAAETLKDAVKQSGD 1317
            .|:......::               ||||.....|::....|: .|.|.||
Mosquito   540 CAETYVQFSIV---------------QAMLHISTDYWSQFIMLQ-PVDQGGD 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 39/186 (21%)
AgaP_AGAP008912XP_319660.4 C1 305..353 CDD:197519 10/38 (26%)
RhoGAP_MgcRacGAP 365..561 CDD:239847 49/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.