DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and ACAP3

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:XP_011538908.1 Gene:ACAP3 / 116983 HGNCID:16754 Length:844 Species:Homo sapiens


Alignment Length:362 Identity:68/362 - (18%)
Similarity:133/362 - (36%) Gaps:96/362 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 LIFVSEANGNVE-------KMDLRKARCIVLKESDESIDNLHVESGPMLMIDCPPYAVYMIMSSA 1078
            :|...:|..:|.       |.|:||     .||:.:..|.:..:               :.:|..
Human   103 MILFDQAQRSVRQQLQSFVKEDVRK-----FKETKKQFDKVRED---------------LELSLV 147

  Fly  1079 RETKIWRHIIREVAHNNGFSLGDQQLTRYDVPVIVDKCINFVYIHGSMSEGIYRKSGSENSMHKL 1143
            |..:..||...||..    :.|...|||        ||...:.:...:...:.:.......:..:
Human   148 RNAQAPRHRPHEVEE----ATGALTLTR--------KCFRHLALDYVLQINVLQAKKKFEILDSM 200

  Fly  1144 MSAFRADAFNVEITRNEYNEHDVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYREL 1208
            :|...|.:...:      ..:.:.:.|..:|:.|...|...:.||         |.||    ||:
Human   201 LSFMHAQSSFFQ------QGYSLLHQLDPYMKKLAAELDQLVIDS---------AVEK----REM 246

  Fly  1209 LARLSAIERETLRRIVGHLVFISSQQAKNKMSV----------------QNLTMIWGPTLLAKKS 1257
            ..:.:||::.||      |...|..::|.:..|                .|....|.....:.::
Human   247 ERKHAAIQQRTL------LQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQN 305

  Fly  1258 DELIYSQKEADVLSDLVVLYKNLFPCS---ADEIKRE------QAMLACLQKYYAAAETLKDAVK 1313
            .:|:|.:|..|.|:   |:..:|..||   .::|:|.      ....:|:.:  |.:|.|:.|..
Human   306 SQLVYQKKLKDALT---VVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQ--ADSEKLRQAWV 365

  Fly  1314 QSGDIKIWISLNPNPENKTEEKTQVNATISPTKTAYE 1350
            |:....|..:...:|::...|:  ::.|.||:.::.:
Human   366 QAVQASIASAYRESPDSCYSER--LDRTASPSTSSID 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 35/197 (18%)
ACAP3XP_011538908.1 BAR 16..225 CDD:299863 25/159 (16%)
PH 279..373 CDD:278594 19/98 (19%)
PH_ACAP 281..377 CDD:270070 20/100 (20%)
ArfGap 413..531 CDD:279720
ANK 711..>798 CDD:238125
ANK repeat 712..743 CDD:293786
Ank_4 715..766 CDD:290365
ANK repeat 745..776 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.