DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and ADAP1

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001271237.1 Gene:ADAP1 / 11033 HGNCID:16486 Length:385 Species:Homo sapiens


Alignment Length:250 Identity:50/250 - (20%)
Similarity:78/250 - (31%) Gaps:95/250 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 AGRSLKHASKRFG----SNFSLGRNKDKADIGIGGRPGGSGEMDLDRRQTMPSTEVFNTIQFSSP 349
            |.|..|...|..|    .:.||||:.|.|...:|                     ||..:..|. 
Human    15 ARRKWKEFEKMLGCAEEGHASLGRDPDWASYTLG---------------------VFICLSCSG- 57

  Fly   350 LNRNGGLPDLRENDAKLQKEDYLRPDPDQE----------DDGCYEVPKTQGKPPSYDEALRSRP 404
                     :..|..::.|...:|.|..:|          :|...  .:.:.|.||:    ..||
Human    58 ---------IHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAAR--ARFESKVPSF----YYRP 107

  Fly   405 SPSDSPMSRNLAQEAAQLVQLRNQRQLSSSSSNGDESPRLPMPAFPPPRLSQQPEQFRMDALQPP 469
            :|||..:.|.      |.::.:.:||                             :|.....|.|
Human   108 TPSDCQLLRE------QWIRAKYERQ-----------------------------EFIYPEKQEP 137

  Fly   470 VRQKRRKNYEHIELRRPPVDSAQLEELNRAAAAAEREESLLISAKNAEAETKTPK 524
            .....|:.:    |.:...|:.|.  |:|.....|||.:|....:|   :.|.||
Human   138 YSAGYREGF----LWKRGRDNGQF--LSRKFVLTEREGALKYFNRN---DAKEPK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850
ADAP1NP_001271237.1 ArfGap 28..137 CDD:214518 30/180 (17%)
PH1_ADAP 141..249 CDD:270072 13/51 (25%)
PH 142..239 CDD:278594 13/50 (26%)
PH2_ADAP 263..368 CDD:241282
PH 266..366 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.