| Sequence 1: | NP_573183.2 | Gene: | RhoGAP15B / 32686 | FlyBaseID: | FBgn0030808 | Length: | 1552 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009290262.1 | Gene: | zgc:162872 / 100004931 | ZFINID: | ZDB-GENE-081022-1 | Length: | 701 | Species: | Danio rerio |
| Alignment Length: | 207 | Identity: | 34/207 - (16%) |
|---|---|---|---|
| Similarity: | 68/207 - (32%) | Gaps: | 55/207 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 613 PLPQAVIEEFDPLSSKCSTLARSNKSNELLLLEH--------LLEEDTYGTV--------KAEQD 661
Fly 662 DVSMCTSEEEPTTSAATSPKPQQPQIVHQNARLLSDSMENMLD-----------------SDQER 709
Fly 710 AKPYLSRMPESA--NKASGPVDLASASRNRTNWFVPDKASCSDVTPNTSKTTPPIEGDSPPTYLE 772
Fly 773 AIGGSKDAAGNQ 784 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| RhoGAP15B | NP_573183.2 | RhoGAP_ARAP | 1095..1277 | CDD:239850 | |
| zgc:162872 | XP_009290262.1 | BAR_ACAPs | 18..217 | CDD:153287 | 1/1 (100%) |
| PH | 265..357 | CDD:278594 | 15/99 (15%) | ||
| PH_ACAP | 266..362 | CDD:270070 | 16/115 (14%) | ||
| ArfGap | 399..504 | CDD:279720 | 3/3 (100%) | ||
| Ank_2 | <508..583 | CDD:289560 | |||
| ANK | 522..638 | CDD:238125 | |||
| ANK repeat | 552..583 | CDD:293786 | |||
| Ank_2 | 557..649 | CDD:289560 | |||
| ANK repeat | 585..616 | CDD:293786 | |||
| ANK repeat | 618..649 | CDD:293786 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||