DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP15B and appl2

DIOPT Version :9

Sequence 1:NP_573183.2 Gene:RhoGAP15B / 32686 FlyBaseID:FBgn0030808 Length:1552 Species:Drosophila melanogaster
Sequence 2:NP_001121547.1 Gene:appl2 / 100000135 ZFINID:ZDB-GENE-081016-2 Length:662 Species:Danio rerio


Alignment Length:428 Identity:84/428 - (19%)
Similarity:141/428 - (32%) Gaps:155/428 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1143 LMSAFRADAFNVEITRNEYNEHDVANVLKRFMRDLPERLLGKLTDSFVFVTELAVASEKIPIYRE 1207
            |:|.|..||..:....|:                    ||..:...|....|:|:|:|      :
Zfish    23 LLSVFEEDAGTLTNYTNQ--------------------LLQSMQRVFGAQNEMALATE------Q 61

  Fly  1208 LLARLSAIERETLRRIVGHLVFISSQQAKNKMSVQNLTMIWGPTLLAKKSDELIYSQ---KEADV 1269
            |..:|...|::......|....|::.|...| ||:.|..:.. .|..:.:|::::..   :|.| 
Zfish    62 LSKQLLEYEKQNFALAKGDEEVINTLQQFAK-SVEELNALHS-ELSTQIADKMVFPMVQFREKD- 123

  Fly  1270 LSDLVVLYKNLFPCSADEIKREQAMLACLQKYYAAAETLKDAVKQSGDIKIWISLNPNPENKTEE 1334
            |:::..| |.:|..:.||  .|.||:    ||                       :..|:.:..|
Zfish   124 LTEISTL-KEIFSIATDE--HEAAMV----KY-----------------------SRLPKKRENE 158

  Fly  1335 KTQVNATISPTKTAYELCREYSAKMQL-----------------P----TH-QLTLY----EVI- 1372
            |.:....   .:.||...:::.|.||.                 |    || |:..:    |:: 
Zfish   159 KVKAEVV---REVAYSRRKQHQAAMQYYCALNALQYRKRVAMLEPMLGYTHAQINFFKKGMELVS 220

  Fly  1373 ------------LNDSLERPLHHDTKVF-----------DVILNWSYWPEED---------RKHN 1405
                        :|:|:|..|..|.:|.           |.:    |.|:.|         :|..
Zfish   221 KKLDSFLNSVSNMNESIESQLEIDAEVMRSSQRELLSVDDSV----YMPDHDQAAVSRALIQKAG 281

  Fly  1406 YLVVRPVEMLREIQRAVKNLATVTPGKEL-----------RFADSRTKTFKTLQCELRDGKIVVS 1459
            ||.:|....|  :..|...|...|.|..|           ...|....:...:.||  |.:....
Zfish   282 YLNIRNKTGL--VTTAWDRLFFFTQGGNLMCQPRGAVAGGMVLDLDNSSVMAVDCE--DRRYCFQ 342

  Fly  1460 KKDKNDKTTIVREIFLQSSTAYLGCERKRDFPWSWAIT 1497
            ....|.||:::           |..|.||::. .|..|
Zfish   343 ITSPNGKTSLI-----------LQAESKREYE-EWICT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP15BNP_573183.2 RhoGAP_ARAP 1095..1277 CDD:239850 28/136 (21%)
appl2NP_001121547.1 BAR 21..235 CDD:299863 51/273 (19%)
BAR-PH_APPL 253..375 CDD:270067 27/136 (20%)
PH 277..377 CDD:278594 23/108 (21%)
PTB_APPL 488..614 CDD:269980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.