DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13001 and Zc4h2

DIOPT Version :9

Sequence 1:NP_573181.1 Gene:CG13001 / 32684 FlyBaseID:FBgn0030806 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_011245889.1 Gene:Zc4h2 / 245522 MGIID:2679294 Length:227 Species:Mus musculus


Alignment Length:330 Identity:121/330 - (36%)
Similarity:157/330 - (47%) Gaps:108/330 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SNERHYYAKLEAIKDI---RDKTLSLEKLKVRIIKEVKLSDDEEKCLEEYRKEMEHLLEEKMSHV 70
            ::|:....|||:||:|   |:|||.:||:|.|:..|.:..:.||:.|:||::||:.||:|||:||
Mouse     2 ADEQEIMCKLESIKEIRNFRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHV 66

  Fly    71 EELRQIHADINDMENIIKQTKENQTRSFDMANRVYEEYLALKYQIDHMRRDYLGLSPLRDLHEEE 135
            ||||.||||||.|||.|||::.:..:..:...|:::||..||..:|.:|.. |||..|.||.|||
Mouse    67 EELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMT-LGLQRLPDLCEEE 130

  Fly   136 GSPISKDRFQTNFLKVAAQSAAAAAAAAAAAASVNQNSSLARPHARHPLMPEATVTALPSGGGQG 200
             ..:|.|.|:..  |...|:.                                            
Mouse   131 -EKLSLDYFEKQ--KAEWQTE-------------------------------------------- 148

  Fly   201 GVGGGGAAGGGGGSVGGGGGGGGNPGHAFMPPAPPGAGSAAAAAAAAAVRLGKGDFSAPPPPPPP 265
                                          |..||...|.|||||||                  
Mouse   149 ------------------------------PQEPPIPESLAAAAAAA------------------ 165

  Fly   266 SNRLQQSPSIGIGHHPSFRSDFNVNLRQQPPPMKSCLSCHQQIHRNAPICPLCKAKSRSRNPKKP 330
                ||   :.:......|.  ....||||||||:||||||||||||||||||||||||||||||
Mouse   166 ----QQ---LQVARKQDTRQ--TATFRQQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKP 221

  Fly   331 KKKNN 335
            |:|.:
Mouse   222 KRKQD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13001NP_573181.1 zf-C4H2 20..325 CDD:287156 108/307 (35%)
Zc4h2XP_011245889.1 zf-C4H2 17..224 CDD:401955 114/311 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4451
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10266
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47935
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005393
OrthoInspector 1 1.000 - - oto92196
orthoMCL 1 0.900 - - OOG6_107194
Panther 1 1.100 - - LDO PTHR31058
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3959
SonicParanoid 1 1.000 - - X4336
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.