powered by:
Protein Alignment wus and AT4G39150
DIOPT Version :9
Sequence 1: | NP_001285355.1 |
Gene: | wus / 32683 |
FlyBaseID: | FBgn0030805 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001190960.1 |
Gene: | AT4G39150 / 830070 |
AraportID: | AT4G39150 |
Length: | 345 |
Species: | Arabidopsis thaliana |
Alignment Length: | 75 |
Identity: | 26/75 - (34%) |
Similarity: | 37/75 - (49%) |
Gaps: | 5/75 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 ERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNR 391
|...|.:|||...||.|||..||...:::.||||...: .||.:.|..:.:||.||. ...:
plant 4 ESEYYDILGVKIDASGAEIKKAYYVQARQVHPDKNPGD---PQAAKNFQILGEAYQVLG--DPEK 63
Fly 392 RRKNKQYQEE 401
|....:|.:|
plant 64 RTAYDKYGKE 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.