DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wus and Dnajc21

DIOPT Version :9

Sequence 1:	NP_001285355.1	Gene:	wus / 32683	FlyBaseID:	FBgn0030805	Length:	406	Species:	Drosophila melanogaster
Sequence 2:	NP_084322.2	Gene:	Dnajc21 / 78244	MGIID:	1925371	Length:	531	Species:	Mus musculus

Alignment Length:	87	Identity:	32/87 - (36%)
Similarity:	46/87 - (52%)	Gaps:	13/87 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   331 YKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIK-----SN 390
            |:.|||...||:.|:..|||||:..:||||..|..  |:|.::|..||.||.|||..:     .|
Mouse     5 YEALGVRRDASEEELKKAYRKLALRWHPDKNLDNA--AEAAEQFKLIQAAYDVLSDPQERAWYDN 67

  Fly   391 RRRK------NKQYQEEEAIVL 406
            .|..      :.:||::...:|
Mouse    68 HREALLKGGLDGEYQDDSLDLL 89

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wus	NP_001285355.1	TM2	47..97	CDD:282945
		DnaJ	327..>385	CDD:223560	25/53 (47%)
		DnaJ	331..385	CDD:278647	25/53 (47%)
Dnajc21	NP_084322.2	DnaJ	3..66	CDD:278647	27/62 (44%)
		DBINO	<181..243	CDD:290603
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	278..309
		zf-C2H2_jaz	314..339	CDD:288983
		C2H2 Zn finger	316..338	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	327..480
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	507..531
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900