powered by:
Protein Alignment wus and CG12020
DIOPT Version :9
Sequence 1: | NP_001285355.1 |
Gene: | wus / 32683 |
FlyBaseID: | FBgn0030805 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647662.1 |
Gene: | CG12020 / 38233 |
FlyBaseID: | FBgn0035273 |
Length: | 366 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 20/55 - (36%) |
Similarity: | 28/55 - (50%) |
Gaps: | 10/55 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 ERNSYKVLGVSATASQAEITAAYRKLSKEY--HPDKVKDEGLRAQAHQRFIEIQQ 379
|.:.|.||.....|::.:||.|||:|:... |.|| ||| |.|:.:.|
Fly 5 ELDYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDK-KDE-------QDFVPLAQ 51
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.