DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wus and Dnajc11

DIOPT Version :9

Sequence 1:NP_001285355.1 Gene:wus / 32683 FlyBaseID:FBgn0030805 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:63 Identity:29/63 - (46%)
Similarity:40/63 - (63%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 DVDGERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLS 385
            ::|.| :.|.:|.|...||..|:.||||:|...|||||.:|..|::||.:.|..:.|||.|||
  Rat     9 ELDNE-DYYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLS 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wusNP_001285355.1 TM2 47..97 CDD:282945
DnaJ 327..>385 CDD:223560 26/57 (46%)
DnaJ 331..385 CDD:278647 25/53 (47%)
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 27/57 (47%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.