powered by:
Protein Alignment wus and CG32641
DIOPT Version :9
Sequence 1: | NP_001285355.1 |
Gene: | wus / 32683 |
FlyBaseID: | FBgn0030805 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_727675.1 |
Gene: | CG32641 / 318136 |
FlyBaseID: | FBgn0052641 |
Length: | 132 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 25/66 - (37%) |
Similarity: | 38/66 - (57%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 ERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNR 391
|.:.|.:|||...|:..||..||::::..|||||.|.....|| |.:|.:|::|||...:.|
Fly 2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTAQ----FRKINEAFNVLSDASARR 62
Fly 392 R 392
:
Fly 63 K 63
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
wus | NP_001285355.1 |
TM2 |
47..97 |
CDD:282945 |
|
DnaJ |
327..>385 |
CDD:223560 |
22/57 (39%) |
DnaJ |
331..385 |
CDD:278647 |
21/53 (40%) |
CG32641 | NP_727675.1 |
DnaJ |
4..65 |
CDD:278647 |
24/64 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.