DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment wus and Dnajb13

DIOPT Version :9

Sequence 1:	NP_001285355.1	Gene:	wus / 32683	FlyBaseID:	FBgn0030805	Length:	406	Species:	Drosophila melanogaster
Sequence 2:	NP_001005885.1	Gene:	Dnajb13 / 308857	RGDID:	1359131	Length:	316	Species:	Rattus norvegicus

Alignment Length:	55	Identity:	22/55 - (40%)
Similarity:	31/55 - (56%)	Gaps:	4/55 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   331 YKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLS 385
            |.||.|:..:..|:|..|||||:.:.||.|..:    ..|.:.|.:|.:||.|||
  Rat     6 YAVLQVNRNSEDAQIKKAYRKLALKNHPLKSNE----PTAPEIFRQIAEAYDVLS 56

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
wus	NP_001285355.1	TM2	47..97	CDD:282945
		DnaJ	327..>385	CDD:223560	20/53 (38%)
		DnaJ	331..385	CDD:278647	20/53 (38%)
Dnajb13	NP_001005885.1	DnaJ	1..312	CDD:223560	22/55 (40%)
		DnaJ	4..65	CDD:278647	22/55 (40%)
		DnaJ_C	138..302	CDD:199909
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810