DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wus and Dnaja4

DIOPT Version :9

Sequence 1:NP_001285355.1 Gene:wus / 32683 FlyBaseID:FBgn0030805 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:80 Identity:36/80 - (45%)
Similarity:44/80 - (55%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 ERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNR 391
            |...|.:|||..:||..||..|||||:.:|||||..|||      ::|..|.|||.|||..|   
  Rat   162 ETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG------EKFKLISQAYEVLSDPK--- 217

  Fly   392 RRKNKQYQE--EEAI 404
              |...|.:  |:||
  Rat   218 --KRDIYDQGGEQAI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wusNP_001285355.1 TM2 47..97 CDD:282945
DnaJ 327..>385 CDD:223560 28/57 (49%)
DnaJ 331..385 CDD:278647 27/53 (51%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 36/80 (45%)
DnaJ 165..223 CDD:278647 31/68 (46%)
DnaJ_C 264..490 CDD:199909
DnaJ_zf 293..359 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.