powered by:
Protein Alignment wus and Dnajc18
DIOPT Version :9
Sequence 1: | NP_001285355.1 |
Gene: | wus / 32683 |
FlyBaseID: | FBgn0030805 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006254608.1 |
Gene: | Dnajc18 / 291677 |
RGDID: | 1310237 |
Length: | 357 |
Species: | Rattus norvegicus |
Alignment Length: | 75 |
Identity: | 29/75 - (38%) |
Similarity: | 43/75 - (57%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 328 RNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNRR 392
||.|.:||||..||..|:..||:||:.::||||....| |...|..|..|::||| ..::|
Rat 81 RNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPG----ATDAFKAIGNAFAVLS--NPDKR 139
Fly 393 RKNKQYQEEE 402
.:..:|.:|:
Rat 140 LRYDEYGDEQ 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.