DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wus and Dnajb9

DIOPT Version :9

Sequence 1:NP_001285355.1 Gene:wus / 32683 FlyBaseID:FBgn0030805 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038967719.1 Gene:Dnajb9 / 24908 RGDID:3070 Length:234 Species:Rattus norvegicus


Alignment Length:67 Identity:28/67 - (41%)
Similarity:41/67 - (61%) Gaps:6/67 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 RNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNRR 392
            :|.|.:|||..:||:.:|..|:.||:.:|||||.|.    ..|..:|.||.:||..||  .:|||
  Rat    37 KNYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKS----PDAEAKFREIAEAYETLS--DANRR 95

  Fly   393 RK 394
            ::
  Rat    96 KE 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wusNP_001285355.1 TM2 47..97 CDD:282945
DnaJ 327..>385 CDD:223560 23/56 (41%)
DnaJ 331..385 CDD:278647 22/53 (42%)
Dnajb9XP_038967719.1 DnaJ 35..>147 CDD:223560 28/67 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.