powered by:
Protein Alignment wus and dnj-24
DIOPT Version :9
Sequence 1: | NP_001285355.1 |
Gene: | wus / 32683 |
FlyBaseID: | FBgn0030805 |
Length: | 406 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498155.3 |
Gene: | dnj-24 / 175745 |
WormBaseID: | WBGene00001042 |
Length: | 249 |
Species: | Caenorhabditis elegans |
Alignment Length: | 79 |
Identity: | 30/79 - (37%) |
Similarity: | 45/79 - (56%) |
Gaps: | 12/79 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 ERNSYKVLGVSATASQAEITAAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKS-- 389
|.:.|..||:|:|:...||..|||||:.::||||..|:..:.:|.|:|.:|.|||.:|:..|.
Worm 5 EDSPYITLGISSTSDDVEIKKAYRKLALKWHPDKHTDDKSKEEAEQKFKKIAQAYEILTDKKKRA 69
Fly 390 ----------NRRR 393
:|||
Worm 70 DLDRTENPGLHRRR 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
wus | NP_001285355.1 |
TM2 |
47..97 |
CDD:282945 |
|
DnaJ |
327..>385 |
CDD:223560 |
25/57 (44%) |
DnaJ |
331..385 |
CDD:278647 |
24/53 (45%) |
dnj-24 | NP_498155.3 |
DnaJ |
9..>111 |
CDD:223560 |
29/75 (39%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.