DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13002 and CheB38c

DIOPT Version :10

Sequence 1:NP_573178.1 Gene:CG13002 / 32681 FlyBaseID:FBgn0030804 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_610061.2 Gene:CheB38c / 35346 FlyBaseID:FBgn0032888 Length:198 Species:Drosophila melanogaster


Alignment Length:120 Identity:29/120 - (24%)
Similarity:53/120 - (44%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LCILQSLRGIQSTTYEILGDDRILDIVCDAAEDRGNTPIRQILDISGLTVDMAADLETLYFNGDI 93
            |.::.....|.:|.|.:|.:|..:...|..... |:..:.:..|:|.:.|:|  |.|.::.:|:|
  Fly     6 LILILGSTDILATDYILLVEDPDIYTPCTDGPP-GSVGLNEAFDVSEMQVEM--DEEGIHVSGNI 67

  Fly    94 KVLIDV-PNNPMAMEVDVFRWERSEWIPTTLAMKRDSFCMSLSNPMELWYPIFLK 147
            .....: |...::..:.|..:.|..|.||........||.::.||...||..:.|
  Fly    68 TTRWSLPPTYRISARMSVLHFNRGNWEPTVFNTLTPDFCDAMFNPNLFWYKYWFK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13002NP_573178.1 DM11 41..202 CDD:128920 27/108 (25%)
CheB38cNP_610061.2 DM11 18..181 CDD:128920 27/108 (25%)

Return to query results.
Submit another query.