DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and DENR

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_003668.2 Gene:DENR / 8562 HGNCID:2769 Length:198 Species:Homo sapiens


Alignment Length:197 Identity:94/197 - (47%)
Similarity:138/197 - (70%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DVGTNSVADRLQLGPREG----VTYPIQMKYCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFER 65
            |:..:|.|| .:..||..    ..||:::.|||.|::|.|||||.|:..||::|||.:.|::|.:
Human     4 DISESSGAD-CKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAK 67

  Fly    66 LKIE----EEAAAAD-----GTDDDKKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVV 121
            |.:|    :||..::     |.:::||:|||||:|.::.||| .||:::.:::..|.|||.||.|
Human    68 LTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKK-TVPQKVTIAKIPRAKKKYVTRV 131

  Fly   122 TGLSTFDIDLKVAAKFFGTKFACGSSVTGDDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQ 186
            .||:||:||||.|.:||..||:||:||||:|||:||||..||:.|||.|||.|:|:|.|||||:.
Human   132 CGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEV 196

  Fly   187 KR 188
            |:
Human   197 KK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 83/165 (50%)
DENRNP_003668.2 DRP1 28..193 CDD:273472 86/169 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..110 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147881
Domainoid 1 1.000 88 1.000 Domainoid score I7973
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 193 1.000 Inparanoid score I3862
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55305
OrthoDB 1 1.010 - - D1490022at2759
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto88772
orthoMCL 1 0.900 - - OOG6_102629
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.