DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and Denr

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_080879.1 Gene:Denr / 68184 MGIID:1915434 Length:198 Species:Mus musculus


Alignment Length:173 Identity:87/173 - (50%)
Similarity:125/173 - (72%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YPIQMKYCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFERLKIEE---------EAAAADGTDD 80
            ||:::.|||.|::|.|||||.|:..||::|||.:.|::|.:|.:|.         |.....|.::
Mouse    27 YPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQETGITEGQGPVGEEE 91

  Fly    81 DKKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACG 145
            :||:|||||:|.::.||| .||:::.:::..|.|||.||.|.||:||:||||.|.:||..||:||
Mouse    92 EKKKQKRGGRGQIKQKKK-TVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCG 155

  Fly   146 SSVTGDDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQKR 188
            :||||:|||:||||..||:.|||.|||.|:|:|.|||||:.|:
Mouse   156 ASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 82/165 (50%)
DenrNP_080879.1 DRP1 28..193 CDD:273472 82/165 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..109 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837964
Domainoid 1 1.000 88 1.000 Domainoid score I7942
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 192 1.000 Inparanoid score I3854
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55305
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto92337
orthoMCL 1 0.900 - - OOG6_102629
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.