DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and denr

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001006814.1 Gene:denr / 448530 XenbaseID:XB-GENE-1002798 Length:200 Species:Xenopus tropicalis


Alignment Length:172 Identity:87/172 - (50%)
Similarity:126/172 - (73%) Gaps:10/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PIQMKYCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFERLKI-----EE----EAAAADGTDDD 81
            |:::.|||.|::|.|||||.|:..||::|||.:.||:|.:|.:     :|    |..|..|.:::
 Frog    30 PLKVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPDEFSKLTLGISPKQETGTVEGQATSGEEEE 94

  Fly    82 KKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGS 146
            ||:|||||:|.::.||| .||:::.:::..|.|||.||.|.||:||:|:||.|.:||..||:||:
 Frog    95 KKKQKRGGRGQIKQKKK-TVPQKVTIAKIPRAKKKYVTRVCGLATFEIELKDAQRFFAQKFSCGA 158

  Fly   147 SVTGDDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQKR 188
            ||||:|||:||||..||:.|||.|||.|:|:|.|||||:.|:
 Frog   159 SVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 83/165 (50%)
denrNP_001006814.1 DRP1 30..195 CDD:273472 83/165 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..112 15/34 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8005
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 189 1.000 Inparanoid score I3778
OMA 1 1.010 - - QHG55305
OrthoDB 1 1.010 - - D1490022at2759
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto102644
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.