DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and denr

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001002697.1 Gene:denr / 436970 ZFINID:ZDB-GENE-040718-450 Length:208 Species:Danio rerio


Alignment Length:208 Identity:91/208 - (43%)
Similarity:134/208 - (64%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TNEDVGTNSVADRLQLGPREGVTYPIQMKYCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFERL 66
            |.|:..:.|..:::.....: ..||:::.|||.|::|.|||||.||..|||:|||.:.||.|.:|
Zfish     3 TTENAESGSPENKVDRADPD-AKYPLKVLYCGVCSLPAEYCEYMPEPAKCKQWLEKNFPDVFAKL 66

  Fly    67 KI----EEEAAAADGTDD-----------------DKKRQKRGGKGLLRVKKKEDVPKRICVSRA 110
            .:    ::|:....|.:|                 :||:|||||:|.::.||| .||:::.:::.
Zfish    67 TLGTAPKQESKGGGGGEDGGGGRGRGEAPPAGEEEEKKKQKRGGRGQIKQKKK-TVPQKVTIAKI 130

  Fly   111 ARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGSSVTGDDEIVIQGDVKDDLFDVIPEKWAEI 175
            .|.|||.||.|.||:||||:||.|.:||..||:||:|||.:|||:||||..||:.|||.|||.|:
Zfish   131 PRAKKKYVTRVCGLATFDIELKEAQRFFAQKFSCGASVTAEDEIIIQGDFTDDIIDVIQEKWPEV 195

  Fly   176 DEDVIEDLGDQKR 188
            |:|.|:|||:.|:
Zfish   196 DDDSIDDLGEVKK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 83/177 (47%)
denrNP_001002697.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/16 (19%)
eIF1_SUI1_like 26..203 CDD:294159 83/177 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..120 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581761
Domainoid 1 1.000 86 1.000 Domainoid score I8077
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 183 1.000 Inparanoid score I3955
OMA 1 1.010 - - QHG55305
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto41548
orthoMCL 1 0.900 - - OOG6_102629
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.