DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and eif1

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_955882.1 Gene:eif1 / 322237 ZFINID:ZDB-GENE-030131-956 Length:113 Species:Danio rerio


Alignment Length:94 Identity:26/94 - (27%)
Similarity:42/94 - (44%) Gaps:18/94 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ADGTDDDKKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFG 139
            ||.|..| .|...|.:..:.::.::            |..:|::|.|.|::. |.|.|...|.|.
Zfish    14 ADATKGD-DRLPAGTEDYIHIRIQQ------------RNGRKTLTTVQGIAD-DYDKKKLVKAFK 64

  Fly   140 TKFACGSSVTGDDE----IVIQGDVKDDL 164
            .||||..:|....|    |.:|||.:.::
Zfish    65 KKFACNGTVIEHPEYGEVIQLQGDQRKNI 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 26/94 (28%)
eif1NP_955882.1 eIF1_SUI1_like 3..113 CDD:412240 26/94 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.