DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and Eif1

DIOPT Version :10

Sequence 1:NP_573176.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_063124804.1 Gene:Eif1 / 287703 RGDID:1306308 Length:151 Species:Rattus norvegicus


Alignment Length:118 Identity:33/118 - (27%)
Similarity:48/118 - (40%) Gaps:29/118 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHMPDDFERLKIEEEAAAADGTDDDKKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVV 121
            ||..|.|        |.|:.|.|            ||....::.:..||    ..|..:|::|.|
  Rat     7 LHSFDPF--------ADASKGDD------------LLPAGTEDYIHIRI----QQRNGRKTLTTV 47

  Fly   122 TGLSTFDIDLKVAAKFFGTKFACGSSVTGDDE----IVIQGDVKDDLFDVIPE 170
            .|::. |.|.|...|.|..||||..:|....|    |.:|||.:.::...:.|
  Rat    48 QGIAD-DYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_573176.1 eIF1_SUI1_like 26..183 CDD:469673 33/118 (28%)
Eif1XP_063124804.1 None

Return to query results.
Submit another query.