DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and SPBC16C6.05

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_596803.1 Gene:SPBC16C6.05 / 2540154 PomBaseID:SPBC16C6.05 Length:190 Species:Schizosaccharomyces pombe


Alignment Length:176 Identity:66/176 - (37%)
Similarity:99/176 - (56%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFERLKIEEEAAA-------ADGTDDDKKRQK-- 86
            ||..||:|:||||:....:||||||:...||.:::|..|::.:.       ..||.|....::  
pombe    14 YCDVCTLPVEYCEFEGTLKKCKEWLKSSHPDVYDKLYGEQDLSKDLENTLNVSGTKDSNAEEQPA 78

  Fly    87 RGGKGLLRVKKKE--DVPKRICVSRAARGKKKSVTVVTGLSTFDIDLKVAAKFFGTKFACGSSVT 149
            :..|...||:::|  .:..::.:....|.|:|.||.|.||..|.|:.|.|||....|||.|:|||
pombe    79 KLTKEEKRVEREEAKRMASKVLIKTIERTKRKRVTTVQGLDAFGIETKKAAKMLANKFATGASVT 143

  Fly   150 ----GDDEIVIQGDVKDDLFDVIPEKWAEIDED---VIEDLGDQKR 188
                ..||||:|||:..|:||.|.||:.|:.||   ::||...:|:
pombe   144 KTADKKDEIVVQGDLNYDIFDFILEKFKEVPEDNIKIVEDTKSKKK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 64/169 (38%)
SPBC16C6.05NP_596803.1 eIF1_SUI1_like 12..179 CDD:294159 63/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2960
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 112 1.000 Inparanoid score I1565
OMA 1 1.010 - - QHG55305
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto100664
orthoMCL 1 0.900 - - OOG6_102629
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.