DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and Y47D3A.21

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_499450.1 Gene:Y47D3A.21 / 176556 WormBaseID:WBGene00012932 Length:192 Species:Caenorhabditis elegans


Alignment Length:193 Identity:103/193 - (53%)
Similarity:133/193 - (68%) Gaps:15/193 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GTNSVADRLQLGPREGVTYPIQMKYCGHCTMPIEYCEYYPEYEKCKEWLELHMPDDFERLKIEEE 71
            |..:|...|..||.:||:||::|.|||.|:||.|||:|..:.:.|:.|...:.|:..|.|:|.:|
 Worm     4 GETAVIQSLAPGPIDGVSYPLKMVYCGQCSMPPEYCDYSGQTDVCRAWATQNAPELLEGLEISDE 68

  Fly    72 AAAADGTDDDKKRQKRGGKG-----------LLRVKKKEDVPKRICVSRAARGKKKSVTVVTGLS 125
             .||||  |:||:|||||||           ....|||...|:::.:.|..|| ||||||:.||:
 Worm    69 -PAADG--DEKKKQKRGGKGSKTGAAAAQAAASGGKKKGGGPQKVTLQREPRG-KKSVTVIKGLA 129

  Fly   126 TFDIDLKVAAKFFGTKFACGSSVTGDDEIVIQGDVKDDLFDVIPEKWAEIDEDVIEDLGDQKR 188
            |||||||||:|.|..||||||||||.|||||||||||||.|:|||||.::.::.|:||||:||
 Worm   130 TFDIDLKVASKLFAQKFACGSSVTGADEIVIQGDVKDDLLDLIPEKWKQVTDEQIDDLGDKKR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 89/167 (53%)
Y47D3A.21NP_499450.1 DRP1 23..187 CDD:273472 89/167 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159833
Domainoid 1 1.000 100 1.000 Domainoid score I4414
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6275
Inparanoid 1 1.050 197 1.000 Inparanoid score I2505
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55305
OrthoDB 1 1.010 - - D1490022at2759
OrthoFinder 1 1.000 - - FOG0004744
OrthoInspector 1 1.000 - - oto17621
orthoMCL 1 0.900 - - OOG6_102629
Panther 1 1.100 - - LDO PTHR12789
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5714
SonicParanoid 1 1.000 - - X3339
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.