DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DENR and EIF1

DIOPT Version :9

Sequence 1:NP_001259630.1 Gene:DENR / 32679 FlyBaseID:FBgn0030802 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_005792.1 Gene:EIF1 / 10209 HGNCID:3249 Length:113 Species:Homo sapiens


Alignment Length:118 Identity:33/118 - (27%)
Similarity:48/118 - (40%) Gaps:29/118 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHMPDDFERLKIEEEAAAADGTDDDKKRQKRGGKGLLRVKKKEDVPKRICVSRAARGKKKSVTVV 121
            ||..|.|        |.|:.|.|            ||....::.:..||    ..|..:|::|.|
Human     7 LHSFDPF--------ADASKGDD------------LLPAGTEDYIHIRI----QQRNGRKTLTTV 47

  Fly   122 TGLSTFDIDLKVAAKFFGTKFACGSSVTGDDE----IVIQGDVKDDLFDVIPE 170
            .|::. |.|.|...|.|..||||..:|....|    |.:|||.:.::...:.|
Human    48 QGIAD-DYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DENRNP_001259630.1 eIF1_SUI1_like 26..183 CDD:294159 33/118 (28%)
EIF1NP_005792.1 eIF1_SUI1_like 3..113 CDD:412240 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.