DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and RPC17

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_012523.2 Gene:RPC17 / 853442 SGDID:S000003548 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:157 Identity:29/157 - (18%)
Similarity:65/157 - (41%) Gaps:46/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQIL----------QK----IKSTKKKFGMRN-------LATVTYEALQ 44
            |:.:....::|::.||::.|          ||    :|.::.| |.:|       |..:|...:.
Yeast     1 MKVLEERNAFLSDYEVLKFLTDLEKKHLWDQKSLAALKKSRSK-GKQNRPYNHPELQGITRNVVN 64

  Fly    45 YL------------------------EESPCKTQTRENIMNYVKDLSSYRLKSQEILQMINDPPT 85
            ||                        |:|.....:.|:....:..|:|::|...|.||::|..|.
Yeast    65 YLSINKNFINQEDEGEERESSGAKDAEKSGISKMSDESFAELMTKLNSFKLFKAEKLQIVNQLPA 129

  Fly    86 SALHTQLLIDDNKAPLTDEENEKIIQL 112
            :.:|...::::..|...::..|:::::
Yeast   130 NMVHLYSIVEECDARFDEKTIEEMLEI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 28/146 (19%)
RPC17NP_012523.2 RNA_pol_Rpb4 10..160 CDD:397794 28/148 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345174
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.960964 Normalized mean entropy S2421
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - LDO PTHR15561
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.740

Return to query results.
Submit another query.