DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and AT5G62950

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001190602.1 Gene:AT5G62950 / 836415 AraportID:AT5G62950 Length:139 Species:Arabidopsis thaliana


Alignment Length:117 Identity:34/117 - (29%)
Similarity:56/117 - (47%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKSTKKKFGMRNLATVT---YEALQYLEESPCKTQTRENIMNY 62
            |:.:......|||.||:..|....::|..  .|.:|.:.   |:...||.|:...|||||:|..:
plant     1 MKIVKANAGALTNFEVLDFLNSRGASKDT--TRVIAPIARSEYKVYDYLVETAASTQTRESINKF 63

  Fly    63 VKDLSSYRLKSQEILQMINDPPTSALHTQLLIDDNKAPLTDEE--NEKIIQL 112
            ......::|...|||.:||..|:|.:....:|::    |.|.|  .:.|::|
plant    64 ADKCKDFKLAKAEILNIINLRPSSIVELLPIIEN----LDDREIDTDGILEL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 32/106 (30%)
AT5G62950NP_001190602.1 RPOL4c 4..122 CDD:128904 33/114 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4697
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634280at2759
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - LDO PTHR15561
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.