DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and AT3G28956

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001325904.1 Gene:AT3G28956 / 822534 AraportID:AT3G28956 Length:140 Species:Arabidopsis thaliana


Alignment Length:155 Identity:39/155 - (25%)
Similarity:66/155 - (42%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKSTKKKFGMRNLATVT---YEALQYLEESPCKTQTRENIMNY 62
            |:.:......|||.|::..|....::|..  .|.:|.:.   |:...||.|:...|||||::...
plant     1 MKIMKANAGALTNFELLDFLNSRGASKDT--TRVIAPIARSEYKVYDYLVETAASTQTRESVNKS 63

  Fly    63 VKDLSSYRLKSQEILQMINDPPTSALHTQLLIDDNKAPLTDEE--NEKIIQLSYKHFHGGETKG- 124
            ......::|...|||.:||..|:|.:....:|::    |.|.|  .:.|::|         .|. 
plant    64 ADKCKDFKLAKAEILNIINLWPSSIVELLPIIEN----LDDREIDTDGILEL---------VKDL 115

  Fly   125 ----AAKETPAEKPAESTAKAGKQS 145
                ...|:|.:...|...:.|:||
plant   116 LPPLPTAESPKDNDEEEETENGEQS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 30/106 (28%)
AT3G28956NP_001325904.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4697
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634280at2759
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - O PTHR15561
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.