DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and crcp

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_012812426.1 Gene:crcp / 549232 XenbaseID:XB-GENE-987451 Length:165 Species:Xenopus tropicalis


Alignment Length:100 Identity:32/100 - (32%)
Similarity:55/100 - (55%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKS-------TKKKFGMRNLATVTYEALQYLEESPCKTQTREN 58
            ||..:...:.|:|.||..:|.::|:       .|...|.:||.|:.||.|:||..|||..|:.|.
 Frog     1 MEVKDANAALLSNYEVFHLLTELKAKQREVRKNKNSVGQQNLNTIMYETLKYLSSSPCHYQSPEI 65

  Fly    59 IMNYVKDLSSYRLKSQEILQMINDPPTSALHTQLL 93
            :..::..:..::|...|.||::|..|::|:..||:
 Frog    66 VREFLTAIKGHKLTKAEKLQLLNHRPSTAVEIQLV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 30/90 (33%)
crcpXP_012812426.1 RNA_pol_Rpb4 10..>100 CDD:281819 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10443
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H40587
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634280at2759
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 1 1.000 - - oto104042
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.