DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and CRCP

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_055293.1 Gene:CRCP / 27297 HGNCID:17888 Length:148 Species:Homo sapiens


Alignment Length:165 Identity:49/165 - (29%)
Similarity:85/165 - (51%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKSTKKK-------FGMRNLATVTYEALQYLEESPCKTQTREN 58
            ||..:...:.|:|.||.|:|..:|..:|:       .|.:||.|:|||.|:|:.::||:.|:.|.
Human     1 MEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEI 65

  Fly    59 IMNYVKDLSSYRLKSQEILQMINDPPTSALHTQLLIDDNKAPLTDEENEKIIQLSYKHFHGGETK 123
            :..::..|.|::|...|.||::|..|.:|:..||::::::..||:|:.|.::..           
Human    66 VREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHT----------- 119

  Fly   124 GAAKETPAEKPAESTAKAGKQSGVKRNAQAKSNPA 158
             .....|||..||.  |....|.|   |..:.:||
Human   120 -VTSILPAEPEAEQ--KKNTNSNV---AMDEEDPA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 36/108 (33%)
CRCPNP_055293.1 RPOL4c 1..127 CDD:128904 39/137 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..148 9/28 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154943
Domainoid 1 1.000 77 1.000 Domainoid score I8906
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40587
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634280at2759
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 1 1.000 - - oto90244
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - LDO PTHR15561
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3651
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.