DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and rpc17

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_594136.1 Gene:rpc17 / 2543653 PomBaseID:SPAPB1E7.10 Length:129 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:29/122 - (23%)
Similarity:63/122 - (51%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKS-----TKKKFGMR-----NLATVTYEALQYL-EESPCKTQ 54
            |:.:....:||||.||...|:::::     |:::...:     ||.|:.:|.|:|| .:..|:..
pombe     1 MKVLEARDAYLTNAEVFFHLKEMENEQNARTQERGAAQALVCENLRTIQFEILKYLSSQGNCEGL 65

  Fly    55 TRENIMNYVKDLSSYRLKSQEILQMINDPPTSALHTQLLIDDNKAPLTDEENEKIIQ 111
            |:|..::.:...:.:.|...|||.::|:.|:|.......|:..:....:|:..|:::
pombe    66 TKERFLDCIAIFNEFELTKAEILVILNNKPSSVPELYACIEGIEERFKEEDIFKLVE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 28/113 (25%)
rpc17NP_594136.1 RNA_pol_Rpb4 10..128 CDD:281819 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - LDO PTHR15561
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3651
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.