DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcp and Crcp

DIOPT Version :9

Sequence 1:NP_573175.2 Gene:Rcp / 32678 FlyBaseID:FBgn0030801 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_446122.1 Gene:Crcp / 114205 RGDID:620753 Length:148 Species:Rattus norvegicus


Alignment Length:148 Identity:42/148 - (28%)
Similarity:78/148 - (52%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METINPTFSYLTNLEVMQILQKIKSTKKK-------FGMRNLATVTYEALQYLEESPCKTQTREN 58
            ||..:...:.|:|.||.|:|..:|..:|:       .|.:||..:|||.|:|:.::|||.|:...
  Rat     1 MEVKDANAALLSNYEVFQLLTDLKEQRKESGKNKHSAGQQNLNAITYETLKYISKTPCKNQSPAI 65

  Fly    59 IMNYVKDLSSYRLKSQEILQMINDPPTSALHTQLLIDDNKAPLTDEENEKIIQLSYKHFHGGETK 123
            :..::..:.|::|...|.||::|..|.:|:..||::::::..||:|:.|.::.........|...
  Rat    66 VQEFLTAMKSHKLTKAEKLQLLNHRPMTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAGPED 130

  Fly   124 GAAKET------PAEKPA 135
            ..:|.|      ..|:||
  Rat   131 EQSKSTSNDAAMEEEEPA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RcpNP_573175.2 RNA_pol_Rpb4 10..112 CDD:281819 34/108 (31%)
CrcpNP_446122.1 RPOL4c 1..126 CDD:128904 36/124 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..148 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348823
Domainoid 1 1.000 74 1.000 Domainoid score I8948
eggNOG 1 0.900 - - E1_KOG4168
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40587
Inparanoid 1 1.050 77 1.000 Inparanoid score I5156
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1634280at2759
OrthoFinder 1 1.000 - - FOG0004828
OrthoInspector 1 1.000 - - oto97361
orthoMCL 1 0.900 - - OOG6_103530
Panther 1 1.100 - - LDO PTHR15561
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.